PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E02958.1.p
Common NameEUGRSUZ_E02958, LOC104445135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 297aa    MW: 31815.1 Da    PI: 9.5626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E02958.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.3e-191863147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W+++Ed+ll ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Eucgr.E02958.1.p 18 KGPWSPDEDDLLRKLVQRHGARNWSLISRSIP-GRSGKSCRLRWCNQ 63
                      79******************************.***********985 PP

2Myb_DNA-binding58.12e-1872114347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEd+l+v+a++++G++ W+tIar +  gRt++ +k++w++ 
  Eucgr.E02958.1.p  72 PFTAEEDDLIVRAHAKYGNR-WATIARLLS-GRTDNAIKNHWNST 114
                       89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.2811368IPR017930Myb domain
SuperFamilySSF466895.5E-3215111IPR009057Homeodomain-like
SMARTSM007171.5E-161766IPR001005SANT/Myb domain
PfamPF002495.3E-191863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-251971IPR009057Homeodomain-like
CDDcd001671.31E-152062No hitNo description
SMARTSM007172.2E-1669117IPR001005SANT/Myb domain
PROSITE profilePS5129421.99370119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2372118IPR009057Homeodomain-like
CDDcd001673.95E-1372115No hitNo description
PfamPF002492.5E-1572114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MELDGAVEPS RRDADRVKGP WSPDEDDLLR KLVQRHGARN WSLISRSIPG RSGKSCRLRW  60
CNQLSPGVEH RPFTAEEDDL IVRAHAKYGN RWATIARLLS GRTDNAIKNH WNSTLKRKYA  120
AAIPDGPEEK KPRSGSPGTP SSSELSDPVP PSGSDSLLQP VAAMTVAGLA APVRTRSESR  180
GVDDRGDDDG PSTLLTLSLP GGESSESGAR REDSSRRDGG TTGARREDPS RRDGGTKTTT  240
AATATATATA TAAAAAETTW FGPEFTTAMR AIIRTEVRNY MTELERGGPA RWGNGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-38171183104MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-38171183104C-Myb DNA-Binding Domain
1msf_C8e-38171183104C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E02958.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057256.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A059C7S00.0A0A059C7S0_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s18620.12e-79(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.18e-64myb domain protein 70